Aktivitas Antioksidan dan Sifat Fungsional Protein Kacang Hijau (Vigna radiata L.) yang Dihidrolisis Menggunakan Enzim Papain

NURUL VANIDIA, Dr.nat. tech. Andriati Ningrum, S.T.P., M.Agr ; Dr. Manikharda, S.T.P., M.Agr.

2022 | Tesis | MAGISTER ILMU DAN TEKNOLOGI PANGAN

Kemunculan stres oksidatif memunculkan kebutuhan akan antioksidan yang dapat dikembangkan dengan peptida bioaktif. Peptida bioaktif salah satunya dapat diperoleh dari hidrolisis yang kacang-kacangan, contohnya kacang hijau (Vigna radiata L.). Penelitian ini bertujuan untuk megetahui aktivitas antioksidan dan sifat fungsional kacang hijau yang dihidrolisis menggunakan enzim papain secara in silico dan in vitro. Penelitian ini menggunakan Rancangan Acak Lengkap Faktorial dengan dua faktor yaitu konsentrasi enzim (2,3, dan 4%) dan lama waktu hidrolisis (90, 120, dan 150 menit). Variabel penelitian yang diukur pada penelitian ini yaitu sifat fungsional protein. Kacang hijau dihidrolisis dengan enzim protease kemudian dianalisis kemampuan antioksidannya secara in vitro yang meliputi DPPH, daya reduksi, dan ABTS. Perlakuan dengan potensi antioksidan tertinggi dianalisis untuk mengetahui sifat fungsionalnya meliputi kelarutan, water holding capacity, oil holding capacity, foaming capacity, foaming stability, emulsion capacity dan emulsion stability. Informasi terkait sekuens peptida dengan potensi antioksidan juga dikaji lebih lanjut. Berdasarkan analisis in silico, diketahui bahwa kacang hijau yang dihidrolisis dengan enzim papain dapat menghasilkan peptida yang memiliki aktivitas antioksidan. Hal ini dikonfirmasi dengan analisis in vitro, hidrolisat protein kacang hijau tertinggi mempunyai kemampuan DPPH radical scavenging (55,61%); daya reduksi sebesar 0,349 dan aktivitas antioksidan ABTS sebesar 88,67%. Proses hidrolisis ternyata mampu meningkatkan kelarutan dengan titik isoelektrik di kisaran pH 4. Sifat fungsional hidrolisat kacang hijau menunjukkan potensi pada emulsion capacity dan emulsion stability. Pola protein hidrolisat kacang hijau juga menunjukkan ukuran peptida yang lebih kecil dibandingkan dengan perlakuan tanpa hidrolisis. Berdasarkan hasil FTIR, terjadi peningkatan gugus aktif yang memiliki peran dalam interaksi dan molekul gugus lain. Komposisi asam amino total dan asam amino bebas mengalami peningkatan dibanding sebelum hidrolisis. Hidrolisat protein kacang hijau didominasi oleh asam amino hidrofobik yaitu fenilalanin, leusin dan ileusin. Hidrolisat protein kacang hijau mengandung 48 peptida yang bersumber dari 16 master protein yang memiliki panjang 7 sampai 41 asam amino dengan berat molekul antara 745 sampai 4298 Da. Sekuens yang mengandung antioksidan yaitu AALDPSAEPLSPGDFIGRWMSLVKPAAEQIGANDVMTAAER EQIRELSK, REQIRELTK, FEELNNDLFR, LSKEQIRELSK, NPQLRDLDMFIR, DGQIYDHLVK, ELSSQDEPFNLR, GEAHEEWETRPSK, KELSSQDEPFNLR, DAERYKAEDEEVK, dan HHHDEDEDEDEDEEEKPR. Hidrolisat protein kacang hijau dapat dikembangkan sebagai antioksidan dan emulsifier.

The emergence of oxidative stress raises the need for antioxidants that can be developed with bioactive peptides. Peptides antioxidants from peptides can be obtained from hydrolysis of legumes, namely mung beans. This study aims to determine the antioxidant activity and functional properties of mung beans hydrolyzed using papain enzymes in silico and in vitro. This study investigate the functional properties of the mung bean protein hydrolysates using a completely randomized factorial design with two factors, enzyme concentration (2,3, and 4%) and hydrolysis time (90, 120, and 150 minutes). The hydrolysate were analyzed for their antioxidant ability in vitro, namely DPPH, reducing power, and ABTS. The hydrolysate with the highest antioxidant potential was then analyzed to determine its functional properties include solubility, water and oil holding capacity, foaming capacity and stability, emulsion capacity and emulsion stability. Information related to peptide sequences that have antioxidant effects was also investigated. Based on in silico analysis, mung bean hydrolyzed with papain enzymes can produce peptides with antioxidant activity. From in vitro analysis, the chosen hydrolysate had DPPH radical scavenging activity of 55.61%; reducing power of 0.349 and ABTS antioxidant activity of 88.67%. The hydrolysis process could increase the solubility with an isoelectric point in the range of pH 4. The functional properties of mung bean hydrolysate showed potential for emulsion capacity and stability. The hydrolysate showed smaller peptide size compared to the protein without hydrolysis. Results from FTIR analysis showed an increase in the active group that has a role in interactions with other group molecules. The composition of total amino acids and free amino acids increased compared to before hydrolysis. The hydrolysate mainly consisted of hydrophobic amino acids, namely phenylalanine, leucine and isoleucine. Overall, the hydrolysate contains 48 peptides sourced from 16 master proteins which have a length of 7 until 41 amino acids with a molecular weight between 745 until 4298 Da. Sequences that contain antioxidants are AALDPSAEPLSPGDFIGRWMSLVKPAAEQIGANDVMTAAER EQIRELSK, REQIRELTK, FEELNNDLFR, LSKEQIRELSK, NPQLRDLDMFIR, DGQIYDHLVK, ELSSQDEPFNLR, GEAHEEWETRAESKEDKA, KELSSQEDDEPFEDKA, KELSSK, and HGEAHEEWETRAESKED. Mung bean protein hydrolysate can be developed as antioxidant and emulsifier.

Kata Kunci : Kacang hijau, hidrolisat protein, antioksidan, in silico, in vitro, Mung bean, protein hydrolysate, antioxidant, in silico, in vitro